DISPLAY QUEUE (display queue attributes)

Use the MQSC command DISPLAY QUEUE to display the attributes of one or more queues of any type.

Using MQSC commands

For information on how you use MQSC commands, see Performing local administration tasks using MQSC commands.

[z/OS]You can issue this command from sources 2CR. For an explanation of the source symbols, see Sources from which you can issue MQSC commands on z/OS®.

Synonym: DIS Q

DISPLAY QUEUE

Read syntax diagramSkip visual syntax diagram DISPLAY QUEUE ( generic-qname ) WHERE(FilterCondition) ALL CFSTRUCT(generic-name)1 CLUSINFO2 CLUSNL(generic-name)CLUSTER(generic-name)CMDSCOPE(' ')CMDSCOPE(qmgr-name)3CMDSCOPE(*)31PSID(integer*)1QSGDISP(LIVE)3QSGDISP(ALL)QSGDISP(QMGR)QSGDISP(COPY)QSGDISP(GROUP)3QSGDISP(PRIVATE)QSGDISP(SHARED)31STGCLASS(generic-name)1TARGTYPE(ALL)4TARGTYPE(TOPIC)TARGTYPE(QUEUE)TYPE(ALL)TYPE(QLOCAL)TYPE(QMODEL)TYPE(QALIAS)TYPE(QREMOTE)TYPE(QCLUSTER)Requested parameters
Requested parameters
Read syntax diagramSkip visual syntax diagram,ACCTQALTDATEALTTIMEBOQNAMEBOTHRESHCLCHNAMECLUSDATECLUSQMGRCLUSQTCLUSTIMECLWLPRTYCLWLRANKCLWLUSEQCRDATECRTIMECURDEPTHCUSTOMDEFBINDDEFPRESPDEFPRTYDEFPSISTDEFREADADEFSOPTDEFTYPEDESCRDISTL5GETHARDENBOIMGRCOVQ5INDXTYPE1INITQIPPROCSMAXDEPTHMAXFSIZE6MAXMSGLMONQMSGDLVSQNPMCLASSOPPROCSPROCESSPROPCTLPUTQDEPTHHIQDEPTHLOQDPHIEVQDPLOEVQDPMAXEVQMIDQSVCIEVQSVCINTQTYPERETINTVLRNAMERQMNAMESCOPE6SHARESTATQ5STREAMQSTRMQOSTARGETTARGTYPETPIPE1TRIGDATATRIGDPTHTRIGGERTRIGMPRITRIGTYPEUSAGEXMITQ
Notes:
  • 1 Valid only on z/OS.
  • 2 On z/OS, you cannot issue this from CSQINP2.
  • 3 Valid only on z/OS when the queue manager is a member of a queue sharing group.
  • 4 Valid only on an alias queue.
  • 5 Not valid on z/OS.
  • 6 Not valid on z/OS or IBM® i.

Usage notes

  1. You can use the following commands (or their synonyms) as an alternative way to display these attributes.
    • DISPLAY QALIAS
    • DISPLAY QCLUSTER
    • DISPLAY QLOCAL
    • DISPLAY QMODEL
    • DISPLAY QREMOTE
    These commands produce the same output as the DISPLAY QUEUE TYPE(queue-type) command. If you enter the commands this way, do not use the TYPE parameter.
  2. [z/OS]On z/OS, the channel initiator must be running before you can display information about cluster queues (using TYPE(QCLUSTER) or the CLUSINFO parameter).
  3. The command might not show every clustered queue in the cluster when issued on a partial repository, because the partial repository only knows about a queue once it has tried to use it.

Parameter descriptions for DISPLAY QUEUE

You must specify the name of the queue definition you want to display. This can be a specific queue name or a generic queue name. By using a generic queue name, you can display either:
  • All queue definitions
  • One or more queues that match the specified name
queue-name
The local name of the queue definition to be displayed (see Rules for naming IBM MQ objects). A trailing asterisk * matches all queues with the specified stem followed by zero or more characters. An asterisk (*) on its own specifies all queues.
WHERE
Specify a filter condition to display only those queues that satisfy the selection criterion of the filter condition. The filter condition is in three parts: filter-keyword, operator, and filter-value:
filter-keyword
Almost any parameter that can be used to display attributes for this DISPLAY command. However, you cannot use the [z/OS]CMDSCOPE, QDPHIEV, QDPLOEV, QDPMAXEV, [z/OS]QSGDISP, or QSVCIEV parameters as filter keywords. You cannot use [z/OS]CFSTRUCT, CLUSTER, [z/OS]PSID, [z/OS]STGCLASS,, or CLUSNLif these are also used to select queues. Queues of a type for which the filter keyword is not a valid attribute are not displayed.
operator
This is used to determine whether a queue satisfies the filter value on the given filter keyword. The operators are:
LT
Less than
GT
Greater than
EQ
Equal to
NE
Not equal to
LE
Less than or equal to
GE
Greater than or equal to
LK
Matches a generic string that you provide as a filter-value
NL
Does not match a generic string that you provide as a filter-value
filter-value
The value that the attribute value must be tested against using the operator. Depending on the filter-keyword, this can be:
  • An explicit value, that is a valid value for the attribute being tested.

    You can use operators LT, GT, EQ, NE, LE or GE only. However, if the attribute value is one from a possible set of values on a parameter (for example, the value QALIAS on the CLUSQT parameter), you can only use EQ or NE. For the parameters HARDENBO, SHARE, and TRIGGER, use either EQ YES or EQ NO.

  • A generic value. This is a character string (such as the character string you supply for the DESCR parameter) with an asterisk at the end, for example ABC*. If the operator is LK, all items where the attribute value begins with the string (ABC in the example) are listed. If the operator is NL, all items where the attribute value does not begin with the string are listed. Only a single trailing wildcard character (asterisk) is permitted.

    You cannot use a generic filter-value for parameters with numeric values or with one of a set of values.

ALL
Specify this to display all the attributes. If this parameter is specified, any attributes that are also requested specifically have no effect; all attributes are still displayed.

On all platforms, this is the default if you do not specify a generic name and do not request any specific attributes.

[z/OS]On z/OS this is also the default if you specify a filter condition using the WHERE parameter, but on other platforms only requested attributes are displayed.

[z/OS]CFSTRUCT ( generic-name)
This parameter is optional and limits the information displayed to those queues where the value of the coupling facility structure is specified in brackets.

The value can be a generic name. If you do not enter a value for this parameter, CFSTRUCT is treated as a requested parameter.

CLUSINFO
This requests that, in addition to information about attributes of queues defined on this queue manager, information about these and other queues in the cluster that match the selection criteria is displayed. In this case, there might be multiple queues with the same name displayed. The cluster information is obtained from the repository on this queue manager.

[z/OS]Note that, on z/OS, you cannot issue DISPLAY QUEUE CLUSINFO commands from CSQINP2.

CLUSNL ( generic-name )
This is optional, and limits the information displayed if entered with a value in brackets:
  • For queues defined on the local queue manager, only those with the specified cluster list. The value can be a generic name. Only queue types for which CLUSNL is a valid parameter are restricted in this way; other queue types that meet the other selection criteria are displayed.
  • For cluster queues, only those belonging to clusters in the specified cluster list if the value is not a generic name. If the value is a generic name, no restriction is applied to cluster queues.
If you do not enter a value to qualify this parameter, it is treated as a requested parameter, and cluster list information is returned about all the queues displayed.
[z/OS]Note: If the disposition requested is SHARED, CMDSCOPE must be blank or the local queue manager.
CLUSTER ( generic-name )
This is optional, and limits the information displayed to queues with the specified cluster name if entered with a value in brackets. The value can be a generic name. Only queue types for which CLUSTER is a valid parameter are restricted in this way by this parameter; other queue types that meet the other selection criteria are displayed.

If you do not enter a value to qualify this parameter, it is treated as a requested parameter, and cluster name information is returned about all the queues displayed.

[z/OS]CMDSCOPE
This parameter applies to z/OS only and specifies how the command runs when the queue manager is a member of a queue sharing group.
CMDSCOPE must be blank, or the local queue manager, if QSGDISP is set to GROUP or SHARED.
''
The command runs on the queue manager on which it was entered. This is the default value.
qmgr-name
The command runs on the queue manager you specify, providing the queue manager is active within the queue sharing group.

You can specify a queue manager name, other than the queue manager on which the command was entered, only if you are using a queue sharing group environment and if the command server is enabled.

*
The command runs on the local queue manager and is also passed to every active queue manager in the queue sharing group. The effect of this is the same as entering the command on every queue manager in the queue sharing group.

You cannot use CMDSCOPE as a filter keyword.

[z/OS]PSID ( integer )
The identifier of the page set where a queue resides. This is optional. Specifying a value limits the information displayed to queues that have an active association to the specified page set. The value consists of two numeric characters, in the range 00 - 99. An asterisk * on its own specifies all page set identifiers. If you do not enter a value, page set information is returned about all the queues displayed.
The page set identifier is displayed only if there is an active association of the queue to a page set, that is, after the queue has been the target of an MQPUT request. The association of a queue to a page set is not active when:
  • The queue is just defined
  • The STGCLASS attribute of the queue is altered, and there is no subsequent MQPUT request to the queue
  • The queue manager is restarted and there are no messages on the queue

This parameter is valid only on z/OS.

[z/OS]QSGDISP
Specifies the disposition of the objects for which information is to be displayed. Values are:
LIVE
This is the default value and displays information for objects defined with QSGDISP(QMGR) or QSGDISP(COPY). If there is a shared queue manager environment, and the command is being executed on the queue manager where it was issued, also display information for objects defined with QSGDISP(SHARED).
ALL
Display information for objects defined with QSGDISP(QMGR) or QSGDISP(COPY).

If there is a shared queue manager environment, and the command is being executed on the queue manager where it was issued, this option also displays information for objects defined with QSGDISP(GROUP) or QSGDISP(SHARED).

In a shared queue manager environment:

DISPLAY QUEUE(name) CMDSCOPE(*) QSGDISP(ALL)
The command lists objects matching name in the queue sharing group, without duplicating those in the shared repository.
COPY
Display information only for objects defined with QSGDISP(COPY).
GROUP
Display information only for objects defined with QSGDISP(GROUP). This is allowed only if there is a shared queue manager environment.
PRIVATE
Display information only for objects defined with QSGDISP(QMGR) or QSGDISP(COPY).
QMGR
Display information only for objects defined with QSGDISP(QMGR).
SHARED
Display information only for objects defined with QSGDISP(SHARED). This is allowed only in a shared queue manager environment.
Note: For cluster queues, this is always treated as a requested parameter. The value returned is the disposition of the real queue that the cluster queue represents.
If QSGDISP(LIVE) is specified or defaulted, or if QSGDISP(ALL) is specified in a shared queue manager environment, the command might give duplicated names (with different dispositions) .
Note: In the QSGDISP(LIVE) case, this occurs only where a shared and a non-shared queue have the same name; such a situation should not occur in a well-managed system.
QSGDISP displays one of the following values:
QMGR
The object was defined with QSGDISP(QMGR).
GROUP
The object was defined with QSGDISP(GROUP).
COPY
The object was defined with QSGDISP(COPY).
SHARED
The object was defined with QSGDISP(SHARED).

You cannot use QSGDISP as a filter keyword.

[z/OS]STGCLASS ( generic-name)
This is optional, and limits the information displayed to queues with the storage class specified if entered with a value in brackets. The value can be a generic name.

If you do not enter a value to qualify this parameter, it is treated as a requested parameter, and storage class information is returned about all the queues displayed.

This parameter is valid only on z/OS.

TARGTYPE ( target-type )
This is optional and specifies the target type of the alias queue you want to be displayed.
TYPE ( queue-type )
This is optional, and specifies the type of queues you want to be displayed. If you specify ALL, which is the default value, all queue types are displayed; this includes cluster queues if CLUSINFO is also specified.
As well as ALL, you can specify any of the queue types allowed for a DEFINE command: QALIAS, QLOCAL, QMODEL, QREMOTE, or their synonyms, as follows:
QALIAS
Alias queues
QLOCAL
Local queues
QMODEL
Model queues
QREMOTE
Remote queues

You can specify a queue type of QCLUSTER to display only cluster queue information. If QCLUSTER is specified, any selection criteria specified by the CFSTRUCT, STGCLASS, or PSID parameters are ignored. Note that you cannot issue DISPLAY QUEUE TYPE(QCLUSTER) commands from CSQINP2.

[UNIX, Linux, Windows, IBM i]On Multiplatforms, QTYPE ( type ) can be used as a synonym for this parameter.

The queue name and queue type [z/OS](and, on z/OS, the queue disposition) are always displayed.

Requested parameters

Specify one or more parameters that define the data to be displayed. The parameters can be specified in any order, but do not specify the same parameter more than once.

Most parameters are relevant only for queues of a particular type or types. Parameters that are not relevant for a particular type of queue cause no output, nor is an error raised.

The following table shows the parameters that are relevant for each type of queue. There is a brief description of each parameter after the table, but for more information, see the DEFINE command for each queue type.

Table 1. Parameters that can be returned by the DISPLAY QUEUE command
Local queue Model queue Alias queue Remote queue Cluster queue
ACCTQ X X N/A N/A N/A
ALTDATE X X X X X
ALTTIME X X X X X
BOQNAME X X N/A N/A N/A
BOTHRESH X X N/A N/A N/A
CFSTRUCT X X N/A N/A N/A
CLCHNAME X X N/A N/A N/A
CLUSDATE N/A N/A N/A N/A X
CLUSNL X N/A X X N/A
CLUSQMGR N/A N/A N/A N/A X
CLUSQT N/A N/A N/A N/A X
CLUSTER X N/A X X X
CLUSTIME N/A N/A N/A N/A X
CLWLPRTY X N/A X X X
CLWLRANK X N/A X X X
CLWLUSEQ X N/A N/A N/A N/A
CRDATE X X N/A N/A N/A
CRTIME X X N/A N/A N/A
CURDEPTH X N/A N/A N/A N/A
CUSTOM X X X X X
DEFBIND X N/A X X X
DEFPRESP X X X X X
DEFPRTY X X X X X
DEFPSIST X X X X X
DEFREADA X X X N/A N/A
DEFSOPT X X N/A N/A N/A
DEFTYPE X X N/A N/A N/A
DESCR X X X X X
DISTL X X N/A N/A N/A
GET X X X N/A N/A
HARDENBO X X N/A N/A N/A
IMGRCOVQ X X N/A N/A N/A
INDXTYPE X X N/A N/A N/A
INITQ X X N/A N/A N/A
IPPROCS X N/A N/A N/A N/A
MAXDEPTH X X N/A N/A N/A
[MQ 9.2.0 Jul 2020]MAXFSIZE X X N/A N/A N/A
MAXMSGL X X N/A N/A N/A
MONQ X X N/A N/A N/A
MSGDLVSQ X X N/A N/A N/A
NPMCLASS X X N/A N/A N/A
OPPROCS X   N/A N/A N/A
PROCESS X X N/A N/A N/A
PROPCTL X X X N/A N/A
PSID X N/A N/A N/A N/A
PUT X X X X X
QDEPTHHI X X N/A N/A N/A
QDEPTHLO X X N/A N/A N/A
QDPHIEV X X N/A N/A N/A
QDPLOEV X X N/A N/A N/A
QDPMAXEV X X N/A N/A N/A
QMID N/A N/A N/A N/A X
QSGDISP X X X X X
QSVCIEV X X N/A N/A N/A
QSVCINT X X N/A N/A N/A
QTYPE X X X X X
RETINTVL X X N/A N/A N/A
RNAME N/A N/A N/A X N/A
RQMNAME N/A N/A N/A X N/A
SCOPE X N/A X X N/A
SHARE X X N/A N/A N/A
STATQ X X N/A N/A N/A
STGCLASS X X N/A N/A N/A
[MQ 9.2.3 Jul 2021][UNIX, Linux, Windows, IBM i] STREAMQ X X N/A N/A N/A
[MQ 9.2.3 Jul 2021][UNIX, Linux, Windows, IBM i] STRMQOS X X N/A N/A N/A
TARGET N/A N/A X N/A N/A
TARGTYPE N/A N/A X N/A N/A
TPIPE X N/A N/A N/A N/A
TRIGDATA X X N/A N/A N/A
TRIGDPTH X X N/A N/A N/A
TRIGGER X X N/A N/A N/A
TRIGMPRI X X N/A N/A N/A
TRIGTYPE X X N/A N/A N/A
USAGE X X N/A N/A N/A
XMITQ N/A N/A N/A X N/A
ACCTQ
Whether accounting (on z/OS, thread-level and queue-level accounting) data collection is to be enabled for the queue.
ALTDATE
The date on which the definition or information was last altered, in the form yyyy-mm-dd.
ALTTIME
The time at which the definition or information was last altered, in the form hh.mm.ss.
BOQNAME
Backout requeue name.
BOTHRESH
Backout threshold.
CLCHNAME
CLCHNAME is the generic name of the cluster-sender channels that use this queue as a transmission queue. The attribute specifies which cluster-sender channels send messages to a cluster-receiver channel from this cluster transmission queue.
CLUSDATE
The date on which the definition became available to the local queue manager, in the form yyyy-mm-dd.
CLUSNL
The namelist that defines the cluster that the queue is in.
CLUSQMGR
The name of the queue manager that hosts the queue.
CLUSQT
Cluster queue type. This can be:
QALIAS
The cluster queue represents an alias queue.
QLOCAL
The cluster queue represents a local queue.
QMGR
The cluster queue represents a queue manager alias.
QREMOTE
The cluster queue represents a remote queue.
CLUSTER
The name of the cluster that the queue is in.
CLUSTIME
The time at which the definition became available to the local queue manager, in the form hh.mm.ss.
CLWLPRTY
The priority of the queue for the purposes of cluster workload distribution.
CLWLRANK
The rank of the queue for the purposes of cluster workload distribution.
CLWLUSEQ
Whether puts are allowed to other queue definitions apart from local ones.
CRDATE
The date on which the queue was defined (in the form yyyy-mm-dd).
CRTIME
The time at which the queue was defined (in the form hh.mm.ss).
CURDEPTH
Current depth of queue.

On z/OS, CURDEPTH is returned as zero for queues defined with a disposition of GROUP. It is also returned as zero for queues defined with a disposition of SHARED if the CF structure that they use is unavailable or has failed.

Messages put on a queue count toward the current depth as they are put. Messages got from a queue do not count toward the current depth. This is true whether operations are done under syncpoint or not. Commit has no effect on current depth. Therefore:
  • Messages put under syncpoint (but not yet committed) are included in the current depth.
  • Messages got under syncpoint (but not yet committed) are not included in the current depth.
CUSTOM
This attribute is reserved for the configuration of new features before separate attributes have been introduced. It can contain the values of zero or more attributes as pairs of attribute name and value in the form NAME(VALUE).
DEFBIND
Default message binding.
DEFPRESP
Default put response; defines the behavior that should be used by applications when the put response type in the MQPMO options has been set to MQPMO_RESPONSE_AS_Q_DEF.
DEFPRTY
Default priority of the messages put on the queue.
DEFPSIST
Whether the default persistence of messages put on this queue is set to NO or YES. NO means that messages are lost across a restart of the queue manager.
DEFREADA
This specifies the default read ahead behavior for non-persistent messages delivered to the client.
DEFSOPT
Default share option on a queue opened for input.
DEFTYPE
Queue definition type. This can be:
  • PREDEFINED (Predefined)

    The queue was created with a DEFINE command, either by an operator or by a suitably authorized application sending a command message to the service queue.

  • PERMDYN (Permanent dynamic)

    Either the queue was created by an application issuing MQOPEN with the name of a model queue specified in the object descriptor (MQOD), or (if this is a model queue) this determines the type of dynamic queue that can be created from it.

    On z/OS the queue was created with QSGDISP(QMGR).

  • TEMPDYN (Temporary dynamic)

    Either the queue was created by an application issuing MQOPEN with the name of a model queue specified in the object descriptor (MQOD), or (if this is a model queue) this determines the type of dynamic queue that can be created from it.

    On z/OS the queue was created with QSGDISP(QMGR).

  • SHAREDYN

    A permanent dynamic queue was created when an application issued an MQOPEN API call with the name of this model queue specified in the object descriptor (MQOD).

    On z/OS, in a queue sharing group environment, the queue was created with QSGDISP(SHARED).

DESCR
Descriptive comment.
[UNIX, Linux, Windows, IBM i]DISTL
Whether distribution lists are supported by the partner queue manager. Supported only on Multiplatforms.
GET
Whether the queue is enabled for gets.
HARDENBO
Whether the back out count is hardened to ensure that the count of the number of times that a message has been backed out is accurate.
Note: This parameter affects only IBM MQ for z/OS. It can be set and displayed on other platforms but has no effect.
IMGRCOVQ
Whether a local or permanent dynamic queue object is recoverable from a media image if linear logging is being used.
Note: This parameter is not valid on IBM MQ for z/OS.
INDXTYPE
Index type (supported only on z/OS).
INITQ
Initiation queue name.
IPPROCS
Number of handles indicating that the queue is open for input.

On z/OS, IPPROCS is returned as zero for queues defined with a disposition of GROUP. With a disposition of SHARED, only the handles for the queue manager sending back the information are returned, not the information for the whole group.

MAXDEPTH
Maximum depth of queue.
[MQ 9.2.0 Jul 2020][UNIX, Linux, Windows, IBM i]MAXFSIZE
The size, in megabytes, of the queue file displayed.

The default value for this attribute is DEFQFS, which stands for default queue file size and equates to a hard-coded value of 2,088,960 MB.

MAXMSGL
Maximum message length.
MONQ
Online monitoring data collection.
MSGDLVSQ
Message delivery sequence.
NPMCLASS
Level of reliability assigned to non-persistent messages that are put to the queue.
OPPROCS
Number of handles indicating that the queue is open for output.

On z/OS, OPPROCS is returned as zero for queues defined with a disposition of GROUP. With a disposition of SHARED, only the handles for the queue manager sending back the information are returned, not the information for the whole group.

PROCESS
Process name.
PROPCTL
Property control attribute.

This parameter is applicable to Local, Alias and Model queues.

This parameter is optional.

Specifies how message properties are handled when messages are retrieved from queues using the MQGET call with the MQGMO_PROPERTIES_AS_Q_DEF option.

Permissible values are:
ALL
To contain all the properties of the message, except those contained in the message descriptor (or extension), select All. The All value enables applications that cannot be changed to access all the message properties from MQRFH2 headers.
COMPAT
If the message contains a property with a prefix of mcd., jms., usr., or mqext., all message properties are delivered to the application in an MQRFH2 header. Otherwise all properties of the message, except those contained in the message descriptor (or extension), are discarded and are no longer accessible to the application.
This is the default value; it allows applications which expect JMS related properties to be in an MQRFH2 header in the message data to continue to work unmodified.
FORCE
Properties are always returned in the message data in an MQRFH2 header regardless of whether the application specifies a message handle.
A valid message handle supplied in the MsgHandle field of the MQGMO structure on the MQGET call is ignored. Properties of the message are not accessible via the message handle.
NONE
All properties of the message, except those in the message descriptor (or extension), are removed from the message before the message is delivered to the application.
PUT
Whether the queue is enabled for puts.
QDEPTHHI
Queue Depth High event generation threshold.
QDEPTHLO
Queue Depth Low event generation threshold.
QDPHIEV
Whether Queue Depth High events are generated.

You cannot use QDPHIEV as a filter keyword.

QDPLOEV
Whether Queue Depth Low events are generated.

You cannot use QDPLOEV as a filter keyword.

QDPMAXEV
Whether Queue Full events are generated.

You cannot use QDPMAXEV as a filter keyword.

QMID
The internally generated unique name of the queue manager that hosts the queue.
QSVCIEV
Whether service interval events are generated.

You cannot use QSVCIEV as a filter keyword.

QSVCINT
Service interval event generation threshold.
QTYPE
Queue type.

The queue type is always displayed.

[UNIX, Linux, Windows, IBM i]On Multiplatforms, TYPE(type) can be used as a synonym for this parameter.

RETINTVL
Retention interval.
RNAME
Name of the local queue, as known by the remote queue manager.
RQMNAME
Remote queue manager name.
SCOPE
Scope of queue definition (not supported on z/OS).
SHARE
Whether the queue can be shared.
STATQ
Whether statistics data information is to be collected.
STGCLASS
Storage class.
[MQ 9.2.3 Jul 2021][UNIX, Linux, Windows, IBM i]STREAMQ
The name of a secondary queue where a copy of each message is put.
[MQ 9.2.3 Jul 2021][UNIX, Linux, Windows, IBM i]STRMQOS
The quality of service to use when delivering messages to the duplicate queue.
TARGET
This parameter requests that the base object name of an aliased queue is displayed.
TARGTYPE
This parameter requests that the target (base) type of an aliased queue is displayed.
TPIPE
The TPIPE names used for communication with OTMA using the IBM MQ - IMS bridge if the bridge is active. This parameter is supported only on z/OS.

[z/OS]For more information about TPIPEs, see Controlling the IMS bridge.

TRIGDATA
Trigger data.
TRIGDPTH
Trigger depth.
TRIGGER
Whether triggers are active.
TRIGMPRI
Threshold message priority for triggers.
TRIGTYPE
Trigger type.
USAGE
Whether the queue is a transmission queue.
XMITQ
Transmission queue name.
For more details of these parameters, see DEFINE queues.